PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zpz_sc01484.1.g00080.1.am.mk
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
Family M-type_MADS
Protein Properties Length: 232aa    MW: 25260.4 Da    PI: 12.3284
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zpz_sc01484.1.g00080.1.am.mkgenomeZGDView Nucleic Acid
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF82.82.1e-26186231146
                                   S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEE CS
                        SRF-TF   1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgkl 46 
                                   kr enk+ rqvtf+kRrng+lKKA+ELSvLCdaeva+iifs++g+l
  Zpz_sc01484.1.g00080.1.am.mk 186 KRMENKISRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSTRGRL 231
                                   799*****************************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5006630.712178232IPR002100Transcription factor, MADS-box
SMARTSM004322.5E-31178232IPR002100Transcription factor, MADS-box
SuperFamilySSF554553.27E-25178231IPR002100Transcription factor, MADS-box
CDDcd002654.22E-34179232No hitNo description
PRINTSPR004045.3E-29180200IPR002100Transcription factor, MADS-box
PfamPF003194.9E-23187232IPR002100Transcription factor, MADS-box
PRINTSPR004045.3E-29200215IPR002100Transcription factor, MADS-box
PRINTSPR004045.3E-29215232IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 232 aa     Download sequence    Send to blast
LAKLCSCVCL RDGLPWTRNG LVVNSAPVLL ALADGTNVAG RQGGMVRGRS LSPARAAGRV  60
RSSAGLMTRA RRGARQLRAR RGETAVDTCP PSARPASPVG VASPPPRHCR ASLSSRARQG  120
VRPGFFHVHP RRHPRCLAGF VDTRREVGAA LQEEKAKKSG REGSRPGANL QLRLRRSMGR  180
GKVELKRMEN KISRQVTFAK RRNGLLKKAY ELSVLCDAEV ALIIFSTRGR LF
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1tqe_S2e-17178232155Myocyte-specific enhancer factor 2B
1tqe_R2e-17178232155Myocyte-specific enhancer factor 2B
1tqe_Q2e-17178232155Myocyte-specific enhancer factor 2B
1tqe_P2e-17178232155Myocyte-specific enhancer factor 2B
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankDQ5123595e-75DQ512359.1 Triticum aestivum MADS-box transcription factor TaAGL8 (AGL8) mRNA, complete cds.
GenBankDQ5123625e-75DQ512362.1 Triticum aestivum MADS-box transcription factor TaAGL5 (AGL5) mRNA, complete cds.
GenBankDQ5344915e-75DQ534491.1 Triticum aestivum MADS3 mRNA, complete cds.
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP4244033
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G03710.34e-29MIKC_MADS family protein